Protein coding transcript 189161

• Transcript: Ll_transcript_93294
• CDS coordinates: 1-336 (+)
• Peptide sequence: QRLLFAQVGNLVLSISFLLQSSQFTNVLIHCVFVNLLRFNPRLLFQKIRGKRLMFVGDSLNRNQWESMVCMVQSVAPPENKTWYKNGSLAIFKIEVNFSSFTTVVQVGSVI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_93294

• Blastp: Protein ESKIMO 1 from Arabidopsis with 62.3% of identity
• Blastx: Protein trichome birefringence-like 28 from Arabidopsis with 65.57% of identity
• Eggnog: expressed protein(ENOG410YA1R)
• Kegg: Link to kegg annotations (AT3G55990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455815.1)
• Pfam: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;