Transcript | Ll_transcript_93312 |
---|---|
CDS coordinates | 237-962 (+) |
Peptide sequence | MQPFRRKTPLFNSETGAIIMKGRKNNNLSIFVVVFSIFLFGIFMYNEDVKSIAEFPFSKPKAQEIQEGSGESKHVEPVVKRVSRKEVLEEESVIVQRDVKNDVVEEESVTVTVSKKSRGKLDKSEGGGEEDSDETQEVIGLETVVEAEKKKEKKKKKNIELQVMVEEEEEEEEEDDEVVEVPPEDCDLFNGKWVFDNMTHPLYKEEQCEFLTSQVTCMKNGRPDSMYQNWRWQPRDCSLPK* |
ORF Type | complete |
Blastp | Protein ESKIMO 1 from Arabidopsis with 51.03% of identity |
---|---|
Blastx | Protein ESKIMO 1 from Arabidopsis with 71.58% of identity |
Eggnog | expressed protein(ENOG410YA1R) |
Kegg | Link to kegg annotations (AT3G55990) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433696.1) |
Pfam | PMR5 N terminal Domain (PF14416.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer