| Transcript | Ll_transcript_93302 |
|---|---|
| CDS coordinates | 237-605 (+) |
| Peptide sequence | MQPFRRKTPLFNSETGAIIMKGRKNNNLSIFVVVFSIFLFGIFMYNEDVKSIAEFPFSKPKAQEIQEGSGESKHVEPVVKRVSRKEVLEEESVIVQRDVKNDVVEEESVIVQRDVKNDVVEEE |
| ORF Type | 3prime_partial |
| Blastp | Protein ESKIMO 1 from Arabidopsis with 73.13% of identity |
|---|---|
| Blastx | Protein ESKIMO 1 from Arabidopsis with 73.13% of identity |
| Eggnog | expressed protein(ENOG410YA1R) |
| Kegg | Link to kegg annotations (AT3G55990) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433696.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer