Protein coding transcript 189230

• Transcript: Ll_transcript_93424
• CDS coordinates: 1647-2060 (+)
• Peptide sequence: MRNILKKLPSVNYMTLEFVTALLLRVSQKSLLNKMDVRNLALEVAPIIMWQKEQRPDFYSQYLNQISKSPSKKSLDPPPGSVSEFDLLADDGEAIVASSPIPLDDGTPVDFGAIEVVQLLIEHHNAIFTDANETVWR*
• ORF Type: complete

Annotations of Ll_transcript_93424

• Blastp: Uncharacterized Rho GTPase-activating protein At5g61530 from Arabidopsis with 64.23% of identity
• Blastx: Uncharacterized Rho GTPase-activating protein At5g61530 from Arabidopsis with 67.65% of identity
• Eggnog: rho GTPase activating protein(ENOG410XRR2)
• Kegg: Link to kegg annotations (AT5G61530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449561.1)
• Pfam: RhoGAP domain (PF00620.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;