Protein coding transcript 1893

• Transcript: Ll_transcript_276006
• CDS coordinates: 986-1375 (+)
• Peptide sequence: MQNMIFCQVSSSKNTLEFLTGDLPVVISCASLALADAGIMMYDLVASVSVSCVGKNLVIDPIFEEENYQDGSLMITCMPSRYEITQLTVTGEWSTPKINEGMQLCLDACAKLAKIMRSCLKEAASDSKE*
• ORF Type: complete

Annotations of Ll_transcript_276006

• Blastp: Exosome complex component RRP41-like from Arabidopsis with 71.93% of identity
• Blastx: Exosome complex component RRP41-like from Arabidopsis with 71.93% of identity
• Eggnog: Phosphorolytic exoribonuclease that removes nucleotide residues following the -CCA terminus of tRNA and adds nucleotides to the ends of RNA molecules by using nucleoside diphosphates as substrates (By similarity)(COG0689)
• Kegg: Link to kegg annotations (AT4G27490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413627.1)
• Pfam: 3' exoribonuclease family, domain 2 (PF03725.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;