Protein coding transcript 189301

• Transcript: Ll_transcript_93979
• CDS coordinates: 145-699 (+)
• Peptide sequence: MKKSYSTQNYMHHIELISKLRHRHLVSALGHCFECSLDDSSVARIFLIFEYIPDGTLKSWISDGHARKLLTWNQRIGAAIGVAKGIQFLHTGTVPGVYSINLKMEDVLLDQNLVAKISSYNLPLLSNMGKGLHGSSSNGSKKFNIDKSIKHEDKSDIHDFGVILLELILGRTIKSMNDADTFKDL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_93979

• Blastp: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 from Arabidopsis with 66.49% of identity
• Blastx: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 from Arabidopsis with 66.67% of identity
• Eggnog: inactive leucine-rich repeat receptor-like protein kinase(ENOG410XPGM)
• Kegg: Link to kegg annotations (AT3G03770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422319.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;