Transcript | Ll_transcript_93988 |
---|---|
CDS coordinates | 1-1308 (+) |
Peptide sequence | SGIPAELSSHYQLEKLDISSNTFVGPFQPALLSLPSITYLNISKNKLTGMLFENISCNSDIDVVDISSNLLTGSLPRCLVPNSGNSVRSVLYARNCLEKPNRNQQPPAFCRTGAFAVGILPDRKKHTQVSKVVLSIGIVGGTLGGVALVLLIFFIIRRKNVKSKMKNHPTRLISENAASGYTSKLLSDARYISQTKKFGAVGLPTYRSFSLEEIDAATNNFGHASFIGEDSYGQMYRGQLKNGLPVAIRCLEMKKSYSTQNYMHHIELISKLRHRHLVSALGHCFECSLDDSSVIRIFLVFEYIPNGTLKSWISGGHARKPLSWTQRIGAAIGVAKGIQFLHTGIVPGVYSINLKIEDVLLDQNLVAKISSYNLPLLSNMGKVRHGSSSSRLKDSSINKSVKHEDKSDIHDFGVMLQELILGRTIKSRKDVDAFKD |
ORF Type | internal |
Blastp | Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 from Arabidopsis with 61.81% of identity |
---|---|
Blastx | Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 from Arabidopsis with 61.81% of identity |
Eggnog | inactive leucine-rich repeat receptor-like protein kinase(ENOG410XPGM) |
Kegg | Link to kegg annotations (AT3G03770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422316.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer