Protein coding transcript 189325

• Transcript: Ll_transcript_93658
• CDS coordinates: 47-1087 (+)
• Peptide sequence: MFHVIPTTVFASKQWTAAGAAVRHQTLAGGNGLSLGEDSSGNKVVDSAAVLQPDDVIRPDGVIHGIDQLLIPRSVQEDFNRRRSLRAIAAVIPEGAPQVDPRTNRLKKPAPVPAGAPPVLPIYDAVAPGPSIAPAPAPGPGGARRHFNGERQVKDFIQTLLHYGGYNEMADILVNLTSLATEMGQLISEGYVLTVLAPNDEAMAKLATEQLSEPGAPEQIMYYHIIPEYQTEESMYNAVRRFGKIRYDTLRLPHKVVAQEADGSVKFGSGDASAYLFDPDIYTDGRISVQGIDGVLFPLEENEEDSNTQKRTTTTTTPLVKVAAKPRRGKLLELTCSMLGAFGKVC*
• ORF Type: complete

Annotations of Ll_transcript_93658

• Blastp: Fasciclin-like arabinogalactan protein 16 from Arabidopsis with 73.2% of identity
• Blastx: Fasciclin-like arabinogalactan protein 15 from Arabidopsis with 69.89% of identity
• Eggnog: Beta-Ig-H3 fasciclin(COG2335)
• Kegg: Link to kegg annotations (AT2G35860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455370.1)
• Pfam: Fasciclin domain (PF02469.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;