Transcript | Ll_transcript_93644 |
---|---|
CDS coordinates | 2-778 (+) |
Peptide sequence | VKPEGAPEVDPRTHRLKKPAPPSKPGSSPALPISDALAPGPSIAPAPAPGPGGPHHHFNGEAQVKGFIQTLLQYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGSPEQIMYYHLIPEYQTEESMYNSVRRFGKVQYDTLRVPHKVVAQEADGSVKFGNGDGSAYLFDPDIYTDGRISVQGIDGVLFPLEEEEDVNRVKPDQLAKVVTVKQRRGKLIEATCWMLGTIGQHSRFTSCQ* |
ORF Type | 5prime_partial |
Blastp | Fasciclin-like arabinogalactan protein 16 from Arabidopsis with 77.91% of identity |
---|---|
Blastx | Fasciclin-like arabinogalactan protein 16 from Arabidopsis with 77.91% of identity |
Eggnog | Beta-Ig-H3 fasciclin(COG2335) |
Kegg | Link to kegg annotations (AT2G35860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448909.1) |
Pfam | Fasciclin domain (PF02469.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer