Transcript | Ll_transcript_93652 |
---|---|
CDS coordinates | 76-387 (+) |
Peptide sequence | MTAEVVAEVKAQEGTQKVEVPVAAKVEEPQKVVAQEENVVVVEGDVKEPEDEEESKPETSEKSPPYKEESNFLSDLKEFERKALNEFKTKLEEAILGNKLYEIQ |
ORF Type | 3prime_partial |
Blastp | Patellin-4 from Arabidopsis with 45.45% of identity |
---|---|
Blastx | - |
Eggnog | Transfer protein(ENOG410XRSQ) |
Kegg | Link to kegg annotations (AT1G30690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440126.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer