Transcript | Ll_transcript_93134 |
---|---|
CDS coordinates | 145-822 (+) |
Peptide sequence | MPRGKGTDAKPRGRMTAYAFFVQTCREEHKKKHPDENVIFAEFSKKCAERWKTMNEKEKKRFHEMADKDKLRYDTEMQSYIPPKGEKVRGKKRKQIKDPNAPKRSLSAFFWFCNDERGKVKAVNPEYGVGDVAKELGKKWSDADITVKQKYEAMAEKDKARYEREMTEYKNKGKPTLLQQQQQHQMLVQQQQQILAQQQQQQQQQQMMAVKDESDEDDDDEDDDE* |
ORF Type | complete |
Blastp | High mobility group protein DSP1 from Sophophora with 83.04% of identity |
---|---|
Blastx | High mobility group protein DSP1 from Sophophora with 84.52% of identity |
Eggnog | high mobility group(COG5648) |
Kegg | Link to kegg annotations (Dmel_CG12223) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013466118.1) |
Pfam | HMG-box domain (PF09011.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer