Transcript | Ll_transcript_101560 |
---|---|
CDS coordinates | 2-580 (+) |
Peptide sequence | THTRNYNFFPIKRFTIHCFFVKSRNQIRRFLLFFIQILRQTHKYNSVSSSDSLIHQSKGKRKCVAMADQGELPEGTLENILEQESLKWVFVGGKGGVGKTTCSSILSILLATVRSSVLIISTDPAHNLSDAFQQRFTKTPTLVNGFSNLYAMEVDPTVEHDEMTEGMDSLFSELAGAIPGIDEAMSFAEMLK* |
ORF Type | 5prime_partial |
Blastp | ATPase ASNA1 homolog from Stegomyia with 64.84% of identity |
---|---|
Blastx | ATPase ASNA1 homolog from Stegomyia with 64.84% of identity |
Eggnog | ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail- anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting (By similarity)(COG0003) |
Kegg | Link to kegg annotations (AaeL_AAEL011136) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460892.1) |
Pfam | Anion-transporting ATPase (PF02374.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer