Protein coding transcript 189428

• Transcript: Ll_transcript_101393
• CDS coordinates: 1927-2415 (+)
• Peptide sequence: MHIHMQEEVGRLTSNLASSRSKAVSLGQVVNVCTTNALTRVMIGRRVFNDGNDGFDPKADEFKSMVVELMVLAGALNIGDFIPALEWLDIQGVQAKMKILHKKFDSFLTNIIEEHKNSKIEKHQDMLSTMLSLKDGPEDGGKLTDIEIKALLLVSSYHIIYN*
• ORF Type: complete

Annotations of Ll_transcript_101393

• Blastp: Flavonoid 3'-monooxygenase from Petunia with 65.33% of identity
• Blastx: Regulator of G-protein signaling 1 from Arabidopsis with 64.93% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438332.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;