Protein coding transcript 189431

• Transcript: Ll_transcript_101374
• CDS coordinates: 101-739 (+)
• Peptide sequence: MFAAGTDTSSSTTEWAIAELIKNPKIRAKLQQELDSVVGHDRLVTEADLAHLPYLEAVVKETFRLHPSTPLSLPRVAAESCEVFGYHIPKGATLLVNVWAIARDPNEWQNPLEFKPERFLPGGEKANVDVKGNDFEVIPFGAGRRICAGLSLGLRVVQLLTATLAHAFDWELENGLNPEKLNMDEAFGLTLQRAVPLLVHPHPRLSPHVYSS*
• ORF Type: complete

Annotations of Ll_transcript_101374

• Blastp: Flavonoid 3'-monooxygenase from Petunia with 75.24% of identity
• Blastx: Flavonoid 3'-monooxygenase from Petunia with 75.36% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451686.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;