Transcript | Ll_transcript_276087 |
---|---|
CDS coordinates | 1-357 (+) |
Peptide sequence | QVLINEHLVKDSLALEFLLELFVTWKQEKGLSSLTSCLKRGGLEGKLMDFFPMNKRTEEHLRAAFEDKGLADIVKLHLAQASQEAKRDLQKEVEEKLSDGQPLKEVVTDIRETAAKHMI |
ORF Type | internal |
Blastp | Protein krasavietz from Sophophora with 58.47% of identity |
---|---|
Blastx | Protein krasavietz from Sophophora with 58.47% of identity |
Eggnog | Basic leucine zipper and W2(ENOG410XR08) |
Kegg | Link to kegg annotations (Dmel_CG2922) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015961994.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer