| Transcript | Ll_transcript_276087 |
|---|---|
| CDS coordinates | 1-357 (+) |
| Peptide sequence | QVLINEHLVKDSLALEFLLELFVTWKQEKGLSSLTSCLKRGGLEGKLMDFFPMNKRTEEHLRAAFEDKGLADIVKLHLAQASQEAKRDLQKEVEEKLSDGQPLKEVVTDIRETAAKHMI |
| ORF Type | internal |
| Blastp | Protein krasavietz from Sophophora with 58.47% of identity |
|---|---|
| Blastx | Protein krasavietz from Sophophora with 58.47% of identity |
| Eggnog | Basic leucine zipper and W2(ENOG410XR08) |
| Kegg | Link to kegg annotations (Dmel_CG2922) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015961994.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer