Protein coding transcript 189501

• Transcript: Ll_transcript_101261
• CDS coordinates: 1192-1857 (+)
• Peptide sequence: MMNRRNKFPFTPSQWQELEHQALIYKYIASGISIPPDLIFTIKRTYLDSPLSSRLLPHHPQHFRWNYLPMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEVLKTTHNTNASSTSTTPSSILSITKNNPALAPTTAQNIFHHHPHQHSSSSSHASHLQQHSFLYHHPPPSRPSSTGLYFQDNNSASLFLDNASCSQNNTDSR*
• ORF Type: complete

Annotations of Ll_transcript_101261

• Blastp: Growth-regulating factor 5 from Arabidopsis with 70.54% of identity
• Blastx: Growth-regulating factor 5 from Arabidopsis with 70.54% of identity
• Eggnog: growth-regulating factor(ENOG410YGVC)
• Kegg: Link to kegg annotations (AT3G13960)
• CantataDB: -
• Mirbase: osa-MIR396h (MI0013048)
• Ncbi protein: Link to NCBI protein (XP_019464482.1)
• Pfam: QLQ (PF08880.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;