Transcript | Ll_transcript_101237 |
---|---|
CDS coordinates | 264-1115 (+) |
Peptide sequence | MVQSELDSERVHLTEIDNVERGSLGRGIRRELSFSRWCDDDGRINFDQQLGNEDVSVEEDSEFELPFPQKSELQSRPLDRERLFHLKFQQRSMQMNGTGTMDIDSINRRGNGSQKYVPFDVENKYEMGTNGDPNIYVGGDGSSGKGSQNPISVADILKTLFLVLMWYTFSLFLTLFNKSLLGDHMGKFPAPFLMNTVHFVMQAVLSKLITWFWSHKFDTNVVMSWKDYFLRVVPTALGTAMDVNLSNASLVFISVTFATMCKSAAPIFLLLFAFAFRNLKKIL* |
ORF Type | complete |
Blastp | Probable sugar phosphate/phosphate translocator At1g06470 from Arabidopsis with 63.44% of identity |
---|---|
Blastx | Probable sugar phosphate/phosphate translocator At1g06470 from Arabidopsis with 60.12% of identity |
Eggnog | membrane(COG0697) |
Kegg | Link to kegg annotations (AT1G06470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440709.1) |
Pfam | Triose-phosphate Transporter family (PF03151.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer