Protein coding transcript 189535

• Transcript: Ll_transcript_101200
• CDS coordinates: 1004-1774 (+)
• Peptide sequence: MDVNLSNASLVFISVTFATMCKSAAPIFLLLFAFAFRLETPSFKLSGIIFIISVGILLTVAKETEFEFWGFTLVMLAAVMSGFRWCMTQILLQKEAYGLKNPLTLMSYVSPIMAVVTALLSLALDPWDEFRENKYFDNLQHLTRSCLLMLFGGTLAFLMVLTEYVLVSVTSAVTVTIAGVVKEAVTILVAVLYFHDEFTWLKGFGLFTIMVGVGLFNWYKYQKLQKGHASDNEHLTTDSAAKYVILEEMDEHDDVI*
• ORF Type: complete

Annotations of Ll_transcript_101200

• Blastp: Probable sugar phosphate/phosphate translocator At1g06470 from Arabidopsis with 76.17% of identity
• Blastx: Probable sugar phosphate/phosphate translocator At1g06470 from Arabidopsis with 76.98% of identity
• Eggnog: membrane(COG0697)
• Kegg: Link to kegg annotations (AT1G06470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461155.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;