Protein coding transcript 189641

• Transcript: Ll_transcript_103118
• CDS coordinates: 210-926 (+)
• Peptide sequence: MPQQVSMNHHLDSSLGIDVPSFFPFTSGVSTSPPYDSDEQPNWCDSPPPTSVINGGAVNYNTSVTALSEDNERLRRSNNMLMSELADMKKLYNDIIYFVQNHVKPVAPSNTYSPSSFIFCNAPTQAPSHVSMVQRPMNQILGYYSTTTNPKQSFQPQHQARVLNSPPNTSRSSVKGVVEGHGSNTCMTKLFGVSLQSKKRVHPEYGSNFTNSETNKARLVLEKDDLGLNLMPPNFSYM*
• ORF Type: complete

Annotations of Ll_transcript_103118

• Blastp: Heat stress transcription factor B-4 from Arabidopsis with 45.87% of identity
• Blastx: Heat stress transcription factor B-4 from Arabidopsis with 51.08% of identity
• Eggnog: Transcription factor(COG5169)
• Kegg: Link to kegg annotations (AT1G46264)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417061.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;