Protein coding transcript 189661

• Transcript: Ll_transcript_103853
• CDS coordinates: 225-1151 (+)
• Peptide sequence: MSSNYNVILKQKKLPLSLLNDRRKQSRVHLLDREPFTDAFGLKTKRKRSTLLAADYESLVQKADGFHEAFEQKYDASVSSEVNEGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCYHLEKHLKENCTHKHMVLLLNKCDLIPAWATKGWLRVLSKEYPTLAFHASINKSFGKGSLLSILRQFARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVCKVAPIPGETKVWQYITLTKRIFLIDCPGVVYHNKDTETDVVLKGVVRVTNLQDAADHIGEVLKRVKKPNLDRA*
• ORF Type: complete

Annotations of Ll_transcript_103853

• Blastp: Nuclear/nucleolar GTPase 2 from Arabidopsis with 82.2% of identity
• Blastx: Nuclear/nucleolar GTPase 2 from Oryza sativa with 81.64% of identity
• Eggnog: Required for a late step of 50S ribosomal subunit assembly. Has GTPase activity (By similarity)(COG1161)
• Kegg: Link to kegg annotations (AT1G52980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456163.1)
• Pfam: NGP1NT (NUC091) domain (PF08153.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;