Protein coding transcript 189673

• Transcript: Ll_transcript_102276
• CDS coordinates: 214-1167 (+)
• Peptide sequence: MTIEQHLVGPLLFQMLPYNRLPASGYSTPSPPPSPLRSPRLRPGRTKTGRFSPAPPPPAVRTVSERLAWLFLSVIVRRQGVFLFAPLIYISCMLVYMGTVSFDIVPIIKHRPAPGSVYRSSELYSKLRDEMDADDSSADTISTLWESAYEGGKWKPYVNRSSEGLPESNGYIYVEANGGLNQQRTSICNAVAVAGYLNATLVIPNFRYHSIWKDPSKFSDIYDREYFVNTLRNDVRVVEEIPKYLMERFGSNMTNVYNFRIMAWSSIQYYTDVVLPKLLEEKVIRISPFANRLSFDAPAVVQRLRCLANYEALRFSSP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_102276

• Blastp: Uncharacterized protein At1g04910 from Arabidopsis with 41.99% of identity
• Blastx: Uncharacterized protein At1g04910 from Arabidopsis with 41.99% of identity
• Eggnog: DUF246 domain-containing protein(ENOG410Z25U)
• Kegg: Link to kegg annotations (AT1G04910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462025.1)
• Pfam: GDP-fucose protein O-fucosyltransferase (PF10250.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;