Protein coding transcript 189807

• Transcript: Ll_transcript_101163
• CDS coordinates: 3-533 (+)
• Peptide sequence: SRTAICCRVTPSQKAQLVQILKSCDYRTLAIGDGGNDVRMIQQADIGVGISGREGLQAARAADYSIGKFRFLKRLILVHGRYSYNRTAFLSQYSFYKSLLICFIQIFFSFISGVSGTSLFNSVSLMAYNVFYTSIPVLVSVLDKDLSEETVMQHPQILFYCQAGRFDIMLLFTLLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_101163

• Blastp: Phospholipid-transporting ATPase 2 from Arabidopsis with 95.78% of identity
• Blastx: Phospholipid-transporting ATPase 2 from Arabidopsis with 95.78% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT5G44240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017425012.1)
• Pfam: haloacid dehalogenase-like hydrolase (PF08282.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;