Protein coding transcript 189811

• Transcript: Ll_transcript_101181
• CDS coordinates: 318-620 (+)
• Peptide sequence: MAYNVFYTSIPVLVSVLDKDLSEETVMQHPQILFYCQAGRLLNPSTFAGWFGRSLFHAIVVFVISIHAYAYDKSEMEEISMVALSGCIWLQAFVVTMETK*
• ORF Type: complete

Annotations of Ll_transcript_101181

• Blastp: Phospholipid-transporting ATPase 2 from Arabidopsis with 88% of identity
• Blastx: Phospholipid-transporting ATPase 2 from Arabidopsis with 88.99% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT5G44240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433482.1)
• Pfam: Phospholipid-translocating P-type ATPase C-terminal (PF16212.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;