Transcript | Ll_transcript_101164 |
---|---|
CDS coordinates | 769-1380 (+) |
Peptide sequence | MFLWFVWLLGEESLWFKRNFLLLPGKVSLDLIVRLMLFMFDSCSSFTILQLVAIWGNLVFFYVINWIFSALPSSGMYTIMFRLCRQPSYWIAVFLMVAAGMGPVLAIKYFRYTYRPSKINTLQQAERLGGPILSFGTIEPQPRSIEKEVSTLSIIQPKDRDPVCEPLLSDSPNSTRSFGAGTAFDFFQSQSRLSLSRHTRKDN* |
ORF Type | complete |
Blastp | Phospholipid-transporting ATPase 2 from Arabidopsis with 67.88% of identity |
---|---|
Blastx | Phospholipid-transporting ATPase 2 from Arabidopsis with 67.88% of identity |
Eggnog | Phospholipid-transporting atpase(ENOG410XPYK) |
Kegg | Link to kegg annotations (AT5G44240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433482.1) |
Pfam | Phospholipid-translocating P-type ATPase C-terminal (PF16212.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer