Protein coding transcript 189822

• Transcript: Ll_transcript_101174
• CDS coordinates: 1004-1318 (+)
• Peptide sequence: MFLWFVWLLGEESLWFKRNFLLLPGKVSLDLIVRLMLFMFDSCSSFTILQLVAIWGNLVFFYVINWIFSALPSSGMYTIMFRLCRQPSYWIAVFVSAFVSFASD*
• ORF Type: complete

Annotations of Ll_transcript_101174

• Blastp: Phospholipid-transporting ATPase 2 from Arabidopsis with 73.08% of identity
• Blastx: Phospholipid-transporting ATPase 2 from Arabidopsis with 73.4% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT5G44240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433482.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;