Protein coding transcript 1900

• Transcript: Ll_transcript_276044
• CDS coordinates: 3-572 (+)
• Peptide sequence: VLDTNFPFLSKAHDDIEGVLTLRMHIPDSQNKREFTSRWDSLTVGKSSNGSIGLNAYGLYMYDTVWLLAYAIDEFLNQGNHVEFSNYTEFVQSSGRSLHVDYMPIFNNGNLLLQSILKANAAGVTGTMRFTDDGLLVHPSYEIINVIGNSLRKIGYWSNGSGLSVVSPEIEDSKSKPLNSSSTSSKGRLY
• ORF Type: internal

Annotations of Ll_transcript_276044

• Blastp: Glutamate receptor 3.2 from Arabidopsis with 41.71% of identity
• Blastx: Glutamate receptor 3.2 from Arabidopsis with 42.94% of identity
• Eggnog: Glutamate receptor, ionotropic(ENOG410XPSH)
• Kegg: Link to kegg annotations (AT4G35290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422698.1)
• Pfam: Receptor family ligand binding region (PF01094.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;