| Transcript | Ll_transcript_103609 |
|---|---|
| CDS coordinates | 201-1223 (+) |
| Peptide sequence | MSPSNGVQKNGGGGNGLNCIEHQVSKFDTLAGVAIKYGVEVADIKRMNGLASDLQMFALKTLRIPLPGRHPPSPIPSLPNGHPKQGFGRRSPPRGKAGMKEPLKSLRLKSLEEEISPAMAILQKYYGLKSSKSRDTFEGTKMAACISASSDHSRDKQLPKASPISDFPSDHYTKSPNPVCNLLTGTEVPEYVPFSEIGDAGSEKSDEKSVRRRQKAEIDSVIGTPERISKEGNSGGSNGFSSTGKPLSGRAKSASRAVLFPELESGWLDSIAVGLGDSILTDRFSGVRKSSSASSLREQQKNNSAATVWPPRWSLKPDLQAAIDGLPIPITCLRGKTALD* |
| ORF Type | complete |
| Blastp | LysM and putative peptidoglycan-binding domain-containing protein 1 from Bos with 51.06% of identity |
|---|---|
| Blastx | LysM and putative peptidoglycan-binding domain-containing protein 1 from Bos with 51.06% of identity |
| Eggnog | peptidoglycan-binding, domain containing 1(ENOG4111TII) |
| Kegg | Link to kegg annotations (510653) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019443262.1) |
| Pfam | LysM domain (PF01476.19) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer