Protein coding transcript 190093

• Transcript: Ll_transcript_103823
• CDS coordinates: 43-627 (+)
• Peptide sequence: MKVYMPCVTVATIPNHSRFIYTSFFAISKANKTTMAATTTTINSAAFNTIQERLSFQKEIKKSKFIAIAGPISDENSAMSFLSQVRDPKATHNCWAYKVGDTYRSNDDGEPSGTAGKPIQSAIASSGIDRVMVVVIRHFGGIKLGTGGLVRAYGGVASECLRNAPTCLVKTKVPMGVEVSFDLLGILYHQNCAV*
• ORF Type: complete

Annotations of Ll_transcript_103823

• Blastp: IMPACT family member in pol 5'region from Thermus with 50.79% of identity
• Blastx: IMPACT family member in pol 5'region from Thermus with 50.79% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439228.1)
• Pfam: Protein of unknown function (DUF3747) (PF12565.7)
• Rfam: -
• GO: -