| Transcript | Ll_transcript_103827 |
|---|---|
| CDS coordinates | 430-789 (+) |
| Peptide sequence | MFMSQVGDTYRSNDDGEPSGTAGKPIQSAIASSGIDRVMVVVIRHFGGIKLGTGGLVRAYGGVASECLRNAPTCLVKTKVPMGVEVSFDLLGILYHQVSSCRCILMTHLIGYECSFRLT* |
| ORF Type | complete |
| Blastp | IMPACT family member in pol 5'region from Thermus with 48.94% of identity |
|---|---|
| Blastx | IMPACT family member in pol 5'region from Thermus with 50.55% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014492735.1) |
| Pfam | Uncharacterized protein family UPF0029 (PF01205.18) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer