Protein coding transcript 190098

• Transcript: Ll_transcript_103819
• CDS coordinates: 207-671 (+)
• Peptide sequence: MAKVQKDQEIQGIKLFGTTIKYGEEESKKKQEGKEDETMEKKPEKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAKPPCHGGGFREGCIYETSNDENKFGLVLEEWEVAMPQSSFRQPCTAKRLRMSSGG*
• ORF Type: complete

Annotations of Ll_transcript_103819

• Blastp: Cyclic dof factor 4 from Arabidopsis with 54.07% of identity
• Blastx: Dof zinc finger protein DOF1.5 from Arabidopsis with 51.74% of identity
• Eggnog: Dof-type zinc finger domain-containing protein(ENOG4111564)
• Kegg: Link to kegg annotations (AT2G34140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425156.1)
• Pfam: Dof domain, zinc finger (PF02701.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;