Protein coding transcript 1901

• Transcript: Ll_transcript_276045
• CDS coordinates: 66-443 (+)
• Peptide sequence: MPSVDFPFLVKAAQSDMFQMSAIAEIVDYYEWRDVSAIYVDDDFGRHGVAVLGDKLAEKNCRIAFKASISRKASKYEIITVLAKVEKMESRILVLHTHEDWGLEVFEVAKEQGMMDAGYVWITTDW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276045

• Blastp: Glutamate receptor 3.6 from Arabidopsis with 53.17% of identity
• Blastx: Glutamate receptor 3.6 from Arabidopsis with 52.38% of identity
• Eggnog: glutamate receptor(ENOG410XQQV)
• Kegg: Link to kegg annotations (AT3G51480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422698.1)
• Pfam: Receptor family ligand binding region (PF01094.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;