Protein coding transcript 190140

• Transcript: Ll_transcript_101660
• CDS coordinates: 44-1363 (+)
• Peptide sequence: MNCLFYWVKHELMEEIEHDKAPILEGRSSQEIEIPVISESLDIVPKTMESYCNSVCAFSRQQNSAAASKELAKSSKKLSGVIVLYVIVMLVEVVGGIKANSLAVISDAAHLLSDIAGFFISLFAVWASGWEATPHQSFGYNRLEVLGAFLSLQLIWVISGFLIYEAIGRILHLNDEVNGMLMFAIAAFGFVLNFIMVVWLGHDHCHHHGFGVSDHNHSHHHHHHSCGDSDSDHADHHSSGRSNHDHGEHHCSGDSNHDHGEHHCSGHSNHGHGKEGVPKINDEEKFGLLSSNESNVLNINLQGAYLHVMVDMIQSVGVMIAGAIIWAKPEWLVVDLMCTLIFSLISLCTTVPMLRNIYGILTERTPSEIDIIKLEDGLRIIRGVQEIHDLHVWSITLGKIVLSCHVVAESGISSIDLLGRIKYYCEKTHKIQHVTIQIE*
• ORF Type: complete

Annotations of Ll_transcript_101660

• Blastp: Metal tolerance protein 1 from Arabidopsis with 47.92% of identity
• Blastx: Metal tolerance protein 1 from Arabidopsis with 48.54% of identity
• Eggnog: cation diffusion facilitator family transporter(COG1230)
• Kegg: Link to kegg annotations (AT2G46800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449727.1)
• Pfam: Cation efflux family (PF01545.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;