Protein coding transcript 190155

• Transcript: Ll_transcript_101966
• CDS coordinates: 221-985 (+)
• Peptide sequence: MQGLQWPGLFHILASRPGGPPYVRLTGLGTSMEALEATGNRLSDFANKLGLPFHFSPVPHKVGNLDLEILNVSKTEAVAVHWLQHSLYDVTGSDTNTLCLLQRLAPKVVTVVEQDLSNAGSFLGRFVEAIHYYSALFDSLGCSYGEESEERHVVEQQVLSREIRNVLAVGGPSRSGELKFHNWREKLQQCGFRGISLSGNAATQASLLLGMFPSEGYTLVEDNGILKLGWKDLCLLTASAWRPPFHTTTLILHH*
• ORF Type: complete

Annotations of Ll_transcript_101966

• Blastp: Protein SCARECROW from Pisum with 92.13% of identity
• Blastx: Protein SCARECROW from Pisum with 90.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413155.1)
• Pfam: GRAS domain family (PF03514.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;