| Transcript | Ll_transcript_101972 |
|---|---|
| CDS coordinates | 197-670 (+) |
| Peptide sequence | MGNWCRLAPKVVTVVEQDLSNAGSFLGRFVEAIHYYSALFDSLGCSYGEESEERHVVEQQVLSREIRNVLAVGGPSRSGELKFHNWREKLQQCGFRGISLSGNAATQASLLLGMFPSEGYTLVEDNGILKLGWKDLCLLTASAWRPPFHTTTLILHH* |
| ORF Type | complete |
| Blastp | Protein SCARECROW from Pisum with 94.08% of identity |
|---|---|
| Blastx | Protein SCARECROW from Pisum with 94.08% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003623699.1) |
| Pfam | GRAS domain family (PF03514.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer