Protein coding transcript 190169

• Transcript: Ll_transcript_103219
• CDS coordinates: 76-600 (+)
• Peptide sequence: MPLTLSLSSTLSPPITASSVNLLSGRRSSGKLPHYTGLKLRPAAASRFSGSRIAPRSARVVCEAQDTAVEVAGITDANWQSLVLESETPVLVEFWAPWCGPCRMIHPIIDELAKDYAGKLKFYKVNTDESPSTATRYGIRSIPTVIIFKNGEKKDAIIGAVPKTTLTTSIEKFL*
• ORF Type: complete

Annotations of Ll_transcript_103219

• Blastp: Thioredoxin M4, chloroplastic from Arabidopsis with 72.44% of identity
• Blastx: Thioredoxin M4, chloroplastic from Arabidopsis with 72.44% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT3G15360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425306.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;