Transcript | Ll_transcript_102953 |
---|---|
CDS coordinates | 15-509 (+) |
Peptide sequence | MATTIGRVLVPTRLVSNNTINVTTCYAFPYLPHRFSNTLSSSHSLKHLSESRKFSLLQTRASSSDETSTSVDTNELFNDLKEKWDALENKSTVVVYGGGAIVAVWLSSTLVGALNTVPLLPKILELVGLGYTGWFVYRYLLFKSSRKELVTDIEDLKKKIGGNE* |
ORF Type | complete |
Blastp | Protein CURVATURE THYLAKOID 1A, chloroplastic from Arabidopsis with 68.75% of identity |
---|---|
Blastx | Protein CURVATURE THYLAKOID 1A, chloroplastic from Arabidopsis with 64.58% of identity |
Eggnog | NA(ENOG4111YWG) |
Kegg | Link to kegg annotations (AT4G01150) |
CantataDB | Link to cantataDB annotations (CNT0000897) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423922.1) |
Pfam | CAAD domains of cyanobacterial aminoacyl-tRNA synthetase (PF14159.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer