Transcript | Ll_transcript_392731 |
---|---|
CDS coordinates | 116-556 (+) |
Peptide sequence | MKSPAPTTKVSRQNPMAATVMSVVGIFTACFTPPDTNNSKSFVDSEEFKSSSASRSGSHKARGSSRGVSITLHNSIQGEPGIVKFTMEEIFQVTRNFSPSFKIGQGGFGAVYKAKLLNGTVVAVKRAKKVVSIVLPYSLAYLCVTT* |
ORF Type | complete |
Blastp | Calmodulin-binding receptor-like cytoplasmic kinase 2 from Arabidopsis with 47.66% of identity |
---|---|
Blastx | Calmodulin-binding receptor-like cytoplasmic kinase 2 from Arabidopsis with 69.54% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G00330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432990.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer