Protein coding transcript 190252

• Transcript: Ll_transcript_103705
• CDS coordinates: 1-753 (+)
• Peptide sequence: LHSFSLKTLPKEESLFNYIPKKQKQLFPEEKKALFPSINSLFIFSSKFEPLIQFLQPHHLKIPIMLRTIIHDLKSRSHRVVQDASSMDPVVVSDGFTQSLWAHIPQELLREVLIRIEASEDTWPQRKSVVACAGVCRSWRHITKEIVKFPQFSSKITFPISVKQPGPREHLLQCFIKRNRSTQTYYLYLNLTSTLGDDGKFLLAARKYRRPTCTDYMISLDADDMSKGSNAHVGKLRSNFLGTKFTIYDAQ
• ORF Type: internal

Annotations of Ll_transcript_103705

• Blastp: Tubby-like F-box protein 3 from Arabidopsis with 68.72% of identity
• Blastx: Tubby-like F-box protein 3 from Arabidopsis with 66.48% of identity
• Eggnog: tubby like protein(ENOG410XQFT)
• Kegg: Link to kegg annotations (AT2G47900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426051.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;