Protein coding transcript 190260

• Transcript: Ll_transcript_101616
• CDS coordinates: 2-499 (+)
• Peptide sequence: GDKRKKLEEEKGIIMRFVIGHSATSGGILDRAIEAEDRKHGDFLRLNHVEGYLELSAKTKTYFATAVNLWDADFYVKVDDDIHVNIATLGETLARHRSKPRIYMGCMKSGPVLSQKGVRYHEPEHWKFGESGNRYFRHATGQLYAISNDLASYIALNQDLLHKYAN
• ORF Type: internal

Annotations of Ll_transcript_101616

• Blastp: Probable beta-1,3-galactosyltransferase 2 from Arabidopsis with 86.14% of identity
• Blastx: Probable beta-1,3-galactosyltransferase 2 from Arabidopsis with 86.14% of identity
• Eggnog: Beta-1,3-galactosyltransferase(ENOG410XV5H)
• Kegg: Link to kegg annotations (AT1G05170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453789.1)
• Pfam: Galactosyltransferase (PF01762.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;