Protein coding transcript 190268

• Transcript: Ll_transcript_101629
• CDS coordinates: 2-478 (+)
• Peptide sequence: GDKRKKLEEEKGIIMRFVIGHSATSGGILDRAIEAEDRKHGDFLRLNHVEGYLELSAKTKTYFATAVNLWDADFYVKVDDDIHVNIATLGETLARHRSKPRIYMGCMKSGPVLSQKGVRYHEPEHWKFGESGNRYFRHATGQLYAISNDLASYIALNQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_101629

• Blastp: Probable beta-1,3-galactosyltransferase 2 from Arabidopsis with 86.71% of identity
• Blastx: Probable beta-1,3-galactosyltransferase 2 from Arabidopsis with 83.83% of identity
• Eggnog: Beta-1,3-galactosyltransferase(ENOG410XV5H)
• Kegg: Link to kegg annotations (AT1G05170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430509.1)
• Pfam: Galactosyltransferase (PF01762.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;