Protein coding transcript 190303

• Transcript: Ll_transcript_102910
• CDS coordinates: 397-1263 (+)
• Peptide sequence: MRRTPPPPIHFLTTAVTDNSAATATSSIMSSYPRQRGRGGRFSGRSFSSGRGQFVTGDSHFRSVRDDNLGHRRGERGNFVNQTQPYQQNSQTFYPRPQPPLPPPPPYQQNSQFRHPYPPHRPPPAIGQQFRPRQKAPDHREWEAAKTPPPPPHCERFKVLSYNILADYLAWDHRRALYFHIPQHMLDWQWRKRSILFELGWWSADIMCFQEVDRFHDLAEELKLKGYTGIWKMRTGNPVDGCAIFWQISRFKLLYEESIEFNKLGLRDNVAQICVLEFINQNGSVPSR*
• ORF Type: complete

Annotations of Ll_transcript_102910

• Blastp: Carbon catabolite repressor protein 4 homolog 6 from Arabidopsis with 56.02% of identity
• Blastx: Carbon catabolite repressor protein 4 homolog 6 from Arabidopsis with 54.73% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5239)
• Kegg: Link to kegg annotations (AT5G11350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457883.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;