Protein coding transcript 190355

• Transcript: Ll_transcript_101809
• CDS coordinates: 530-1228 (+)
• Peptide sequence: MRHPLQHLRGNALCAFRSQGLHVDLLGEDLTSKDIEDAQKACLLVNAPLICRAASRVPFSVLKYAMTLDGKIAASSGHASWISSKESRNLVFELRGRSDALIVGGNTVRRDNPRLTARHGGGHMPIRIVMSQSLNLPEEANLWDMSEVSTIVVTQRGARRSFQKLLASKGVEVVEFDMLNPRDVMEYFHDRGYLSIFWECGGTLAASAISSGLIHKVLFIGFNFLFPWEKHK*
• ORF Type: complete

Annotations of Ll_transcript_101809

• Blastp: Riboflavin biosynthesis protein PYRR, chloroplastic from Arabidopsis with 81.19% of identity
• Blastx: Riboflavin biosynthesis protein PYRR, chloroplastic from Arabidopsis with 80.62% of identity
• Eggnog: Converts 2,5-diamino-6-(ribosylamino)-4(3h)-pyrimidinone 5'-phosphate into 5-amino-6-(ribosylamino)-2,4(1h,3h)- pyrimidinedione 5'-phosphate (By similarity)(COG0117)
• Kegg: Link to kegg annotations (AT3G47390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422284.1)
• Pfam: RibD C-terminal domain (PF01872.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;