Protein coding transcript 190359

• Transcript: Ll_transcript_101815
• CDS coordinates: 1392-1862 (+)
• Peptide sequence: MVEMSQALNLTDVCYKQVGPDMLISGFLQPMPDLAPIIPSLDATVAVDPTISPYEPSIIFFYKAWDPFGAFSNFSPHPIQMPDENGNYVTWLSVEHYYQAHKFVGVDDTFAQNCVEMIKSVRSPEEAARIGRSMQKQRPYLVLSQMVFQTSLKLLI*
• ORF Type: complete

Annotations of Ll_transcript_101815

• Blastp: Riboflavin biosynthesis protein PYRR, chloroplastic from Zea with 64.08% of identity
• Blastx: Riboflavin biosynthesis protein PYRR, chloroplastic from Zea with 66.87% of identity
• Eggnog: Converts 2,5-diamino-6-(ribosylamino)-4(3h)-pyrimidinone 5'-phosphate into 5-amino-6-(ribosylamino)-2,4(1h,3h)- pyrimidinedione 5'-phosphate (By similarity)(COG0117)
• Kegg: Link to kegg annotations (101202729)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422284.1)
• Pfam: Domain of unknown function (DUF1768) (PF08719.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;