Transcript | Ll_transcript_101817 |
---|---|
CDS coordinates | 1392-2075 (+) |
Peptide sequence | MVEMSQALNLTDVCYKQVGPDMLISGFLQPMPDLAPIIPSLDATVAVDPTISPYEPSIIFFYKAWDPFGAFSNFSPHPIQMPDENGNYVTWLSVEHYYQAHKFVGVDDTFAQNCVEMIKSVRSPEEAARIGRSMQKQRPYLIRSDWDNIKIEVMYKALKCKFSIYPHLNSMLLSTAGSVLVEASPHDLFWGGGRDGEGLNHLGRLLMKLRSEFLGEKSSSETPTVGL* |
ORF Type | complete |
Blastp | Riboflavin biosynthesis protein PYRR, chloroplastic from Zea with 68.18% of identity |
---|---|
Blastx | Riboflavin biosynthesis protein PYRR, chloroplastic from Zea with 69.67% of identity |
Eggnog | Converts 2,5-diamino-6-(ribosylamino)-4(3h)-pyrimidinone 5'-phosphate into 5-amino-6-(ribosylamino)-2,4(1h,3h)- pyrimidinedione 5'-phosphate (By similarity)(COG0117) |
Kegg | Link to kegg annotations (101202729) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422284.1) |
Pfam | Domain of unknown function (DUF1768) (PF08719.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer