Protein coding transcript 190460

• Transcript: Ll_transcript_103489
• CDS coordinates: 466-777 (+)
• Peptide sequence: MGKQKYPMGNKQNIDGMSSHGCRDLQGSSVLIDNNIVNNQASADTMLTAPPLCQLDVEVIKNLPPEVFSELNEMYGGKLVDFVAKGKGTNESARSVRNLIIEQE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_103489

• Blastp: DNA repair protein REV1 from Arabidopsis with 53.19% of identity
• Blastx: DNA repair protein REV1 from Arabidopsis with 39.86% of identity
• Eggnog: Poorly processive error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by polIV. Exhibits no 3-5 exonuclease (proofreading) activity. May be involved in translesional synthesis in conjunction with the beta clamp from polIII (By similarity)(COG0389)
• Kegg: Link to kegg annotations (AT5G44750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421546.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;