Protein coding transcript 19047

• Transcript: Ll_transcript_418548
• CDS coordinates: 271-795 (+)
• Peptide sequence: MEDSEPPFFTRFFKWEPAKSAMLGNSFQRKLTIVKNGGTTPLEKPKRRASVSSGGRSGSLPEKSQRSRSVSVNPDRARVRGRSPAFTALTANFESPKDRNLSTPPPMVAKLYPKSRSPDSVKPAPKAAAIAQLTSTFEQPPSARDSLIPRSLRASSDASKSSTNKNEQEEESLNS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_418548

• Blastp: Villin-4 from Arabidopsis with 62.89% of identity
• Blastx: Villin-5 from Oryza sativa with 60.12% of identity
• Eggnog: capping protein (actin filament) gelsolin-like(ENOG410XR0A)
• Kegg: Link to kegg annotations (AT4G30160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442412.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;