Protein coding transcript 190569

• Transcript: Ll_transcript_102083
• CDS coordinates: 1-450 (-)
• Peptide sequence: MADPMLEDNYPIKGLYQALAVAAMCLQVEADTRPWISDVVIALEFLAKTKVEAGQGQHAEESSVQQEDSCGDHESNDNSDDYDDDEDDDNDNDECEDEDEDDVDDLENEFNHGQGNSSKARTQWDEDADLSLSSRHDPRQPIPLLTKGHP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_102083

• Blastp: Probable serine/threonine-protein kinase PBL23 from Arabidopsis with 78.85% of identity
• Blastx: Probable serine/threonine-protein kinase PBL23 from Arabidopsis with 78.46% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G20530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440713.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;