Transcript | Ll_transcript_102176 |
---|---|
CDS coordinates | 92-565 (+) |
Peptide sequence | MFRRRVISSILKHTKEASQIHNIRATQHSFKLLTPPIVKHSFHSFRSHYPFLILKLGHNVGYIRSFSRIASAEAAGHKEGLKVFVNGGAHAQKAVGIWLFGSAAWVFSMVVLGGITRLTRSGLSMTDWKFTGSLPPLSDEEWLQEFEKYKQSPEYKR* |
ORF Type | complete |
Blastp | Cytochrome c oxidase assembly protein COX15 from Arabidopsis with 54.82% of identity |
---|---|
Blastx | Cytochrome c oxidase assembly protein COX15 from Arabidopsis with 54.82% of identity |
Eggnog | Catalyzes the oxidation of the C8 methyl side group on heme O porphyrin ring into a formyl group (By similarity)(COG1612) |
Kegg | Link to kegg annotations (AT5G56090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435718.1) |
Pfam | Cytochrome oxidase assembly protein (PF02628.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer