Protein coding transcript 190596

• Transcript: Ll_transcript_102177
• CDS coordinates: 252-1283 (+)
• Peptide sequence: MVVLGGITRLTRSGLSMTDWKFTGSLPPLSDEEWLQEFEKYKQSPEYKRVNKGMKIEDFKFIYWMEYAHRMWGRGLGIMFALPYSYFLHKGYITVRLGLRLSALFALGAGQGFIGWWMVKSGLEEPPSEYSQPRVSPYRLAAHLTSAFAIYSGLVWTALSVVMPEPPAESLTWVRGAVKVKRLALPVGLLVGLTAISGAFVAGNDAGHAFNTFPKMGDVWIPDDIFEMKPLIRNFFENTSTVQLDHRILATATLISVCALWWSTRKLDIHPAVRSVIGSTLGMAALQVTLGVSTLLSYVPVSLGSAHQAGALTLMTFMLLLNHTVRKPSLSLLKSLPQVVKAN*
• ORF Type: complete

Annotations of Ll_transcript_102177

• Blastp: Cytochrome c oxidase assembly protein COX15 from Arabidopsis with 86.01% of identity
• Blastx: Cytochrome c oxidase assembly protein COX15 from Arabidopsis with 79.38% of identity
• Eggnog: Catalyzes the oxidation of the C8 methyl side group on heme O porphyrin ring into a formyl group (By similarity)(COG1612)
• Kegg: Link to kegg annotations (AT5G56090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435718.1)
• Pfam: Cytochrome oxidase assembly protein (PF02628.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;