Protein coding transcript 190598

• Transcript: Ll_transcript_102182
• CDS coordinates: 197-802 (+)
• Peptide sequence: MGDKNKPSSSKTNTQNAKTSMYSKTLSNIGNLIKLLPTGTVFLFQFLNPVLTNNGHCTTLNKYLSGAFLFFCGFNCAFSSFTDSYTGSDGQRHYGIVTTKGLYPSPAADGVNLSVYKLRVGDFAHAFLSVVVFAVLGLLDTDSVQCFYPEFETGQKLLLQVAPPVIGVVASTVFMVFPSNRHGIGYPTSADSNDTSQKSNA*
• ORF Type: complete

Annotations of Ll_transcript_102182

• Blastp: Protein DMP2 from Arabidopsis with 56.74% of identity
• Blastx: Protein DMP2 from Arabidopsis with 56.74% of identity
• Eggnog: Protein of unknown function (DUF679)(ENOG410YF1H)
• Kegg: Link to kegg annotations (AT3G21550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419568.1)
• Pfam: Protein of unknown function (DUF679) (PF05078.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;